PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 317aa    MW: 33888.1 Da    PI: 6.4059
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004835.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.6e-383589660
      zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                 +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  Do004835.1 35 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 89
                68***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-302189IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8543589IPR003851Zinc finger, Dof-type
PfamPF027017.8E-323589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MLSSHCDSVL PYAAAGRRAV LLDHRRYRPN VEVAPNCPRC DSPNTKFCYY NNYSLSQPRY  60
FCKGCRRYWT KGGSLRNVPV GGGCRKNRRG KPVRAVPVVD AVAAGAGGAA AAAFSHRSSS  120
FPAGTLRPDL LLDGMVGSPA GLCHPMDNAD KPAAVVEGST IDLALLYAKF LNHQPAAVEQ  180
CTILPESLDT LSGSSSSDMS PNVPPPPDHH PFARQNGFRE LSAPASADPR LPAPQQCPDV  240
RSEVLGELSF SVDQSCYDSL GLPTDGDDLI LPSTWHTEAK YEPFDPLPED AMGLHGGDDV  300
WSSALACQGL EAALCRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872621e-106BT087262.1 Zea mays full-length cDNA clone ZM_BFb0021J09 mRNA, complete cds.
GenBankJX4284771e-106JX428477.1 Zea mays subsp. mays clone pUT3073 DOF20 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961942.11e-157PREDICTED: dof zinc finger protein DOF1.8-like
TrEMBLK3Z7W31e-157K3Z7W3_SETIT; Uncharacterized protein
STRINGSi022633m1e-156(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.16e-35Dof family protein